Premium Peptides
A straightforward, single-peptide option centered on growth-axis and metabolic pathways. Simple on its own and easy to pair with other metabolic products.
Reported purity: 99.75%
Price: $64.99
Available formats
- 10mg - $64.99
Product specifications
- Listed sizes
- 10mg
- Format
- Vial
- Reference molecular formula
- C221H366N72O67S
- Reference molecular weight
- 5136 g/mol
- Reference CAS number
- 218949-48-5
- Reference sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Database reference values, not a batch measurement. Salts and water change the supplied mass; the batch COA reports measured identity, purity and content.
One-letter sequence; the reference structure adds an N-terminal (E)-hex-3-enoyl group and a C-terminal amide.
Price: $64.99 Availability: In stock