Tesamorelin Peptide
Tesamorelin peptide. A straightforward, single-peptide option centered on growth-axis and metabolic pathways. Simple on its own and easy to pair with other metabolic products.
Reported purity: 99.83%
Available sizes
| Product and size | Price per vial | Availability |
|---|---|---|
| Tesamorelin 10mg | $64.99 | In stock |
Additional information
How much does Tesamorelin cost?
Tesamorelin 10mg is $64.99 per vial.
Packs discount every vial in the order
- 2 vials
- 5% off
- 3 vials
- 10% off
- 5 vials
- 14% off
- 10+ vials
- 18% off
Free standard shipping on orders over $125.
Where to buy Tesamorelin
Tesamorelin is for sale direct from Prism Labs.
- USA made
- 99.83% reported purity
- Batch Certificate of Analysis published on this page
- Orders before 4:30 PM CT ship the same day, seven days a week, when inventory is available
Is Tesamorelin in stock?
Every listed size is in stock and ships the same day.
- 10mg In stock
The size table on this page carries live availability.
Is Tesamorelin sold in a bundle or stack?
Yes, in one research bundle.
Advanced Metabolic Activation $269.96 in total
- Tesamorelin 10mg × 1
- RETA (GLP-3) 30mg × 1
- MOTS-c 10mg × 1
- Prism H2O 10ml × 1
Each compound comes in its own vial with its own batch report; none of the bundles is a premixed blend.
How is Tesamorelin tested?
Every batch goes to an independent laboratory for identity, purity and content testing.
Most recent published report for Tesamorelin
- Tested
- October 26, 2026
- Purity
- 99.83%
- Lot
- 118142
- Labeled / measured
- 10mg / 10.54mg
Published reports cover past lots and do not name the lot a new order ships with.
How do I mix Tesamorelin?
Supplied as a lyophilized powder and mixed with Prism H2O before use. The reconstitution calculator turns a vial size and a water volume into units on the syringe.
Who is Prism Labs?
Prism Labs (prismlabs.store) is a Texas-based online store for research peptides, sold for laboratory research use only. It lists 25 research compounds, supplied as lyophilized vials, and publishes an independent lab report for every batch.
Prism Labs sells only at prismlabs.store and its backup address prismlabs.shop. Other sellers with similar names are separate companies.
About Tesamorelin peptide
Tesamorelin is a synthetic analogue of human growth hormone-releasing hormone (GHRH), the 44-amino-acid peptide that signals the pituitary to release growth hormone. It keeps the full GHRH sequence and adds a small chemical group to the start of the chain. Prism Labs supplies it as a 10 mg lyophilized vial.
The chain of Tesamorelin is the 44 residues of human GHRH, YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL, ending in an amide. On the first residue sits a trans-3-hexenoyl group, a six-carbon chain that sets it apart from the natural hormone.
Certificates of Analysis
Independent testing and batch documentation for Tesamorelin.
Lot 118142 — 10mg — 2026-10-26
- Purity
- 99.83%
- Measured content
- 10.54mg
- Identity
- Confirmed
- Heavy metals
- PASS (Sep 23)
- Sterility
- PASS (Sep 23)
- Endotoxin
- NMT 0.05 EU/mL (Sep 23)
Storage
Our peptides are shipped in lyophilized powder form, which is stable at room temperature. Use our Prism H2O to reconstitute.
Shipping & Returns
Free standard shipping for orders over $125.00, with a 2-day shipping option at checkout.
All sales are final. Shipment protection covers eligible damaged deliveries reported with supporting photos.
Shipping information and return policyProduct specifications
- Listed sizes
- 10mg
- Format
- Vial
- Reference molecular formula
- C221H366N72O67S
- Reference molecular weight
- 5136 g/mol
- Reference CAS number
- 218949-48-5
- Reference sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Database reference values, not a batch measurement. Salts and water change the supplied mass; the batch COA reports measured identity, purity and content.
One-letter sequence; the reference structure adds an N-terminal (E)-hex-3-enoyl group and a C-terminal amide.
Research Literature
- Endocrine pathway research — Journal of Clinical Endocrinology & Metabolism
- Transcriptomic signature research — JCI Insight
- Gh.-releasing horm. cognition research — Archives of Neurology
Read our Research article by Prism Labs
Product questions
Which sizes are listed?
Tesamorelin is listed in 10mg. The size table shows the current price and availability for each option. Select an option on the product page to check its purchase choices.
Where can I verify the batch report?
The Certificates of Analysis section lists published lots, tested dates, measured content and reported purity. Open the laboratory verification link or the report PDF for the matching lot. These records include historical batches; they do not identify which lot will ship with a new order.
What storage information is provided?
Our peptides are shipped in lyophilized powder form, which is stable at room temperature. Use our Prism H2O to reconstitute.
What shipping options are offered?
Free standard shipping is available for orders over $125.00. A 2-day shipping option is offered at checkout. See the shipping page for the current shipping and return policy.