Premium Peptides
A straightforward, single-peptide option centered on growth-axis and metabolic pathways. Simple on its own and easy to pair with other metabolic products.
Reported purity: 99.75%
Price: $64.99
Available formats
- 10mg - $64.99
Product specifications
- Listed sizes
- 10mg
- Format
- Vial
- Reference molecular formula
- C221H366N72O67S
- Reference molecular weight
- 5136 g/mol
- Reference CAS number
- 218949-48-5
- Reference sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Database reference values, not a batch measurement. Salts and water change the supplied mass; the batch COA reports measured identity, purity and content.
One-letter sequence; the reference structure adds an N-terminal (E)-hex-3-enoyl group and a C-terminal amide.
Additional information
How much does it cost?
The 10mg price is $64.99 per vial. Packs discount every vial in the order: 2 vials 5% off, 3 vials 10% off, 5 vials 14% off, 10 or more vials 18% off. Free standard shipping on orders over $125.
Where to buy it
This product is for sale direct from Prism Labs, USA made, at 99.75% reported purity, with the batch Certificate of Analysis published on this page. Orders placed before 4:30 PM CT ship the same day, seven days a week, when inventory is available.
Is it in stock?
Every listed size (10mg) is in stock and ships the same day. The size table on this page carries live availability.
How is it tested?
Every batch goes to an independent laboratory for six checks: identity, purity, content, heavy metals, sterility and endotoxins. The most recent published report for this product was tested September 23, 2026 at 99.83% purity. Lot 118142 was labeled 10mg and measured 10.28mg. Published reports cover past lots and do not name the lot a new order ships with.
How do I mix it?
Supplied as a lyophilized powder and mixed with Prism H2O before use. The reconstitution calculator turns a vial size and a water volume into units on the syringe.
Price: $64.99 Availability: In stock